Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.845851

NP_845851

Description degT/dnrJ/eryC1/strS family protein
Activity vioa
Family vioa
Evidence IDA - direct assay
Phylum Bacteria
OS Bacillus anthracis
GB NP_845851
SQ
MNSIPFLRASIVPVNEYLGELEKIDISHIYTNYGPLNQHFEEKIMSEFFDSKGAVTTVAN
ATLGLMAAIQFKKRKKGKYALMPSFTFPATPLAAIWCGLEPYFIDVSLDDWCMDKTLLLD
KIDELKDEVAVVVPYATFGSWMDLKEYEELERKGIPVVVDAAPGFGLMHEGIHYGQNFSG
MMVYSFHATKPFGIGEGGMIYSNNEEEINQIKRMGNFGFDHNRECTMMGFNCKMTEYAAA
IGIATMNKWNQKVQERNRISEWYTQLLQSTGLMKKGWEVQKTEAVIHQFMPILCPEKIHN
TQVIEVLKKQNIEARLYFSPSCHQQDFFKHYKSTDLTNTNKIAKQIISLPLWEGMTQEIV
EQIIMCLMQKVVSTDE
 
last changed 2010/10/19 10:14

B6db sequences