Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.929517

NP_929517

Description hypothetical protein
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Photorhabdus luminescens
GB NP_929517
SQ
MMSKTHYSESLNLKSHWMPFSANRSFQRDPRLIVAAEGQWLKDDKGRQIYDSLSGLWTCG
AGHTRTEIQQAVAAQLSTLDYSPGFQFGHPLSFQLAEKIANLTPGDLNHVFFTSSGSESV
DTAVKMVRAYWRVKGQPEKTKLIGRALGYHGVNIAGTSLGGIGGNRKMFGQLMDVDHLPH
TLQTDMAFTPGMAETGGAELANEMLKLIELHDASNIAAVIVEPVSGSAGAIIPPKGYLQR
LREICDQHNILLIFDEVITGFGRMGRWTGAEYFGVTPDLLNFAKQITNGAIPLGGVVASS
EIYEAFMSQSLPEHSVEFSHGYTYSAHPVACAAGLATLDLLDKNHLIQRSAELAPHFETA
LHALRNCPNVTDIRNCGLVGAIELAARDGDTAVRPFDASMALWKAGFYVRFGGDTLQFGP
MFNAERADLDRLFDAVGEVLHHID
 
last changed 2005/03/16 20:05

B6db sequences