Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.931817

NP_931817

Description Lipopolysaccharide biosynthesis protein WecE
Activity 2.6.1.33
Family 2.6.1.33
Evidence ISS - similarity
Phylum Bacteria
OS Photorhabdus luminescens
GB NP_931817
SQ
MIPFNKPPVVGTELDYMKQAMESGKLCGDGGFTKRCEEWMEQHFNCPKVLLTPSCTAALE
MAAILLNIQPGDEVIMPSFTFVSSSNAFVLRGATVVFVDIRPDTMNIDETKIEAAITAKT
RVIVPVHYAGVACEMDTIMALAEKYNLFVVEDAAQGVMSTYKGRALGTIGHIGCYSFHET
KNYSSGGEGGAALINDQSLISRAEIVREKGTNRSQFFRGQVDKYTWRDIGSSYLMSELQA
AYLWAQLEEAEKINERRLALWNTYYQALKPLVDAGLLTLPVIPEELEHNAHMFYIKLKDV
EERSAFNSYMKDAGVLTVFHYVSLHTSPGGEKFGRFHGEDCFTTCESDRLVRLPMFYNIT
DAEQQIVIKHIREYFA
 
last changed 2007/11/15 14:55

B6db sequences