Activities | Families | Sequences | Fold types | References | Help
B6db sequences: np.933098

NP_933098

Description Lipopolysaccharide biosynthesis protein
Activity 2.6.1.33
Family 2.6.1.33
Evidence ISS - similarity
Phylum Bacteria
OS Vibrio vulnificus
GB NP_933098
SQ
MFETNYMIPFNKPPVTGEELQFIQEAISCGKLSGDGEFSRKCENWFVSHTGTTKALLTPS
CTHALEMAAMLIDIQPGDEVIMPSYTFVSTANAFVLRGAKVVFVDIRADTMNIDESKIEV
AITERTKAIVPVHYAGVACDMDTIMGLSDKYGLYVIEDAAQGMMSTYKGRALGSIGHIGT
YSFHETKNYTSGGEGGLLLVNDQSFSQRAEIIREKGTNRNQFFRGMVDKYTWVDVGSSML
PSEIQSAYLWAQLINAKRINEKRINDWNYYFDSLLPLKEKGLIELPNIPIECTHNAHMFY
IKLPDLTQRTRFIEAMFKQGVLSVFHYIPLHSSPAGKSFGRFNGKDIYTTMESEKLVRLP
MFYGLALSERNKIISTIFDILES
 
last changed 2007/11/15 15:00

B6db sequences