Activities | Families | Sequences | Fold types | References | Help
B6db sequences: oapt.psepu

OAPT_PSEPU

Description OMEGA-AMINO ACID--PYRUVATE AMINOTRANSFERASE (OMEGA-APT) (BETA-ALANINE--PYRUVATE AMINOTRANSFERASE)
Activity 2.6.1.18
Family 2.6.1.18
Evidence IDA - direct assay
Phylum Bacteria
OS Pseudomonas putida
GB OAPT_PSEPU
SQ
NMPEHAGASLASQLKLDAHWMPYTANRNFLRDPRLIVAAEGSWLVDDKGRKVYDSLSGLW
TCGAGHTRKEIQEAVAKQLSTLDYSPGFQYGHPLSFQLAEKITDLTPGNLNHVFFTDSGS
ECALTAVKMVRAYWRLKGQATKTKMIGRARGYHGVNIAGTSLGGVNGNRKLFGQPMQDVD
HLPHTLLASNAYSRGMPKEGGIALADELLKLIELHDASNIAAVFVEPLAGSAGVLVPPEG
YLKRNREICNQHNILLVFDEVITGFGRTGSMFGADSFGVTPDLMCIAKQVTNGAIPMGAV
IASTEIYQTFMNQPTPEYAVEFPHGYTYSAHPVACAAGLAALCLLQKENLVQSVAEVAPH
FEKALHGIKGAKNVIDIRNFGLAGAIQIAPRDGDAIVRPFEAGMALWKAGFYVRFGGDTL
QFGPTFNSKPQDLDRLFDAVGEVLNKLLD
 
last changed 2005/03/16 20:05

B6db sequences