Activities | Families | Sequences | Fold types | References | Help
B6db sequences: ptsj.salty

PTSJ_SALTY

Description Putative transcriptional regulatory protein ptsJ
Activity mocr
Family mocr
Evidence ISS - similarity
Phylum Bacteria
OS Salmonella typhimurium
GB PTSJ_SALTY
SQ
MIDGKTANEIFDSIRQHIIAGTLRAEDSLPPVRELASELKVNRNTVAAAYKRLITAGLAQ
SLGRNGTVIKGSPSPVALEGGDPHTPLHDLSGGNPDPQRLPDLSRYFARLSRTPHLYGDA
PVSPELHAWAARWLRDATPVAGEIDITSGAIDAIERLLCAHLLPGDSVAVEDPCFLSSIN
MLRYAGFSASPVSVDSEGMQPEKLERALNQGARAVILTPRAHNPTGCSLSARRAAALQNM
LARYPQVVVIIDDHFALLSSSPWQPVIAQTTQHWAVIRSVSKTLGPDLRLAIVASDSATS
AKLRLRLNAGSQWVSHLLQDLVYACLTDPEYQHRLTQTRLFYAARQQKLARALQQYGIAI
SPGDGVNAWLPLDTHSQATAFTLAKSGWLVREGEAFGVSAPSHGLRITLSTLNDSEINTL
AADIHQALNR
 
last changed 2005/03/16 20:05

B6db sequences