Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp016841945

WP016841945

Description C-terminal domain
Activity dihydrorhizobitoxine.synthase
Family dihydrorhizobitoxine.synthase
Evidence IDA - direct assay
Phylum Viridiplantae
OS Bradyrhizobium elkanii
GB WP016841945
SQ
MSSSFAKDSQLPFSAETAVLHAGYRRDPVTKAVAVPIYQNTAYELDGDLNHIADVYNVKA
DGFTYTRIINPTTRALEKRYAAVDMGSDSLAVASGQAATFLAIVNLSSGEVGDNIVASPY
LYGNTWNLLHNTLKRLGISVRTADPRRPETFERAIDDRTICLFGEVISNPCLIPLPVKQL
AEIGRKHGVPLVVDNTTTPLVCRPSDLGAAITTYSATKYICGHGTTLGGLIVDNGKFSYR
GASRFPLFNSPDEAHGGIIWRNALQDVDDLGKSEVLLKARMTWLRDTGAAIAPFASFQLI
QGLETLPLRMKQHCANARIVADVLKEHPKVRRVFYPGLFEGADRETVDQTLNPAYGHGAM
VMFEVEDEQAGRKFIQNVDLMYHVSNVGDARTLVTHPVSTTHTTVPREKREAAGIFGGSI
RLCVGIEDVDDIVRDLDRALSAI
 
last changed 2014/02/24 15:51

B6db sequences