Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.006639426

WP_006639426

Description neotrehalosadiamine antibiotic synthesis protein NtdA
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus sonorensis
GB WP_006639426
SQ
MKTASENMTCTSKQLFALLNDLKEGKLAGECRIDDTLANQKLKETLQQDQFDMTANLLNR
MDSPPSRVDFMPLHRLITEEEVEDVIHAVKDVLPTGQFTSGSYVGVFEAEIAALLRKKHV
MASSSGTDAMIVALKAAGVGQGDEVIMPANSFAATENAVLAAGGTPVFCDIDPVTFCMDP
SEIEACVTLKTKCILPVHLYGKLPDMEAIAKIADKYGIPIIEDACQSIGVSDLGKNSLCS
ILSFNPYKNLGTCGKAGAIVTDDPSFASACMEYMYHGFELNQKNKKAADYGFNAKIDNLQ
AAIGLARMKYLSLNNLKRLYLADRYIAHLQQYEDRGLIKLPQMTDDHVWHLFTIKIINGN
RDQVKDMMLKFHNVQTDIYYPILSHHQHTPLVKANYQHTSLPVTESVHKQMLQLPLYPGL
TVEEQDKVMEALIDVVS
 
last changed 2014/02/21 11:58

B6db sequences