Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.009673737

WP_009673737

Description putative daunorubicin biosynthesis sensory transduction protein DnrJ
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Paenibacillus
GB WP_009673737
SQ
MLTTKNKYWGTSKDYLHLLDRIKTGRDVEPDCFENHLVNTQLIEKLYISGRENTINTWIR
SLFPALSEFRGKVDFLPVNRLISAEEVEAILAVMRVVLPTGQFTSGPYVNRFEEILSGYL
RKKYIIATSSGTDAAMVALLALGLRPGDEVIMPANSFAATENAVLAVGGIPVYADIDPHT
YTLDPASTEVAITPRTRFILPVHLYGKKANMASLRELADRYRLKIVEDACQAIGVTELGR
EGDALILSFNPYKNVGVCGKGGAIALDDEEAAQRCMQFSYHGFEVNVKNRKVRDFGYNSR
MDNLQAAIGIERMKHLSLNNFKRTVLADRYRQGLQSLADSQKIRLPELSDDHVWHHFPIQ
ILSADRDLVRRELMDKYSAETDIYYPVLSHRQNTPFVNVRYKDARLPQTEQTHSRLLHLP
MYPHLTWEEQDHLMEGLRRVIGV
 
last changed 2014/02/21 11:57

B6db sequences