Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.009796899

WP_009796899

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Nitrobacter sp. Nb-311A
GB WP_009796899
SQ
MKGDLMIYHSILEGTGNTPIVRLSRLFRDWPCEVLAKLEMFNPGGSVKDRPARYIIERGL
ADGSIRPNSHIIESSSGNLAIALAMACRIYGLRFTAVVDPKISPLNLKIIQCYGGNIELV
TEKDSQGGYLGTRIERIKCLLREWPDAVWVNQYANERNWQSHYHGEGEEILRHLDRPVDY
LVLGVSTSGTVHGISRRLREAWPELKVVGVDAVGSILFGTPPYPRDLPGIGASRVPELFQ
RDEIDQAIHIDDYESAVACRELVNHEGIFAGGSSGSVIAAIQQLCADLPRDTRILTILPD
RGERYLDTIYDDEWLSRMKDRHLVRTAKNSVNLSMEHTA
 
last changed 2014/07/04 14:55

B6db sequences