Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.010287371

WP_010287371

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Kurthia massiliensis
GB WP_010287371
SQ
MHKLAAQLNDTLQQQAPTVLDMLSNLGKEMYYPTEGILAQSAEAKSAKKYNATIGTALEN
GKPMHLKVIQDTLSAYEPKDLYLYAPPQGKAELRQAWREKMIKENPSLVGKTFGTPIVTN
ALTHGLSIIADLFADNGDALIIPDKNWENYDMVFGIRRGANVVTYPLYDDAGLFNATALK
ETIIAQKDATGKAIVLLNFPNNPTGYTPTPQEADTIVQAIKEAADTGVKVVAVTDDAYFS
LFFEDSITESLFGRLADVHENVLAVKIDGATKEEYVWGFRVGFITYAAKNEAILHALEEK
TRGIIRATISSGPHPSQTFVLKALQSPEFEQQKQEKFDIMKGRAIKTKQVLDSGKYDDAW
DYYPFNSGYFMCLKLKNVTADELRPVALEKYGVGAIALGETDLRVAFSCIEEDGIEELFD
LLYAAVKDVEASK
 
last changed 2014/03/04 12:11

B6db sequences