Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.010328264

WP_010328264

Description biosynthesis operon protein NtdA
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus vallismortis
GB WP_010328264
SQ
MQKQVKVTGKSKENMLLLKHLKGDVQGKELVIEDSIVNERWRHVLKENTDIENDLFNYQK
HREIRNVPFLPVDRLITNDEVDDILKTLTKVLPTGKFTSGSYVDQFEKVLSTYLHKRYVI
ATSSGTDAIMIGLLALGLNRGDEVIMPANSFSATENAVLALGGVPVYADINPQTFCIDPN
KIEEAITPYTKFILPVHLYGKHSEMEHIRQIANRYQLKVIEDACQGIGLTDLGKYADITT
LSFNPYKNVGVCGKAGAIATDNEELAEKCIQFSYHGFEVNVKNKKAINFGFNSKMDNIQA
AIGLERIKYLSLNNFKRLFLADRYMTQLAELQNKGLIELPELSEDHVWHLFPIKVRTEDR
TNIMTTLNDDFGVQTDVYYPVLSHMQKTPLVQDKYAKLQLVHTEKAHRQVLHLPLYPSFT
LEEQDRVLEGLFDVIKQEIGV
 
last changed 2014/02/21 11:57

B6db sequences