Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.011495046

WP_011495046

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Shewanella denitrificans
GB WP_011495046
SQ
MFETIHSSILSCIGNTPIVRLERLFADYPQTVLTKLEMLNPGGSVKDRPARYMLEQGIAN
GTINDNSHIIESSSGNLAIALAMSCLQLGLLFTAVVDPKISPTNLKLLEIFGAKVVQVTE
KDCNNGYLLTRINTVNQLLLSTPNAVWINQYANPDNWRSHYYGEAEEILQQVAAPIDYLV
IGASTSGTLMGISRRLKEAYPQMRVIAVDIVGSVLFGGHSAPRELPGIGASRVPELLNAS
EVDDVIYVDDYESAMACHRLVKTESIFAGGSSGSAVAAIEKLLPQIPANSTILTLFADRG
DRYLDLVYDQDWLNMVKANHEQSLRAQTPFLIEKTA
 
last changed 2014/07/04 14:57

B6db sequences