Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.015933256

WP_015933256

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Methylobacterium nodulans
GB WP_015933256
SQ
MMPDTGMVVGGTPLVALDALFPPDVVPVFAKLELLNVGGSVKDRTAHYMVAQAVSTGRIG
PGSHIIESSSGNLGIALAMIAKQRGLNFTAVVDPNIAPANLRLIEAFGGRIDMVDERDEE
GGYLHTRVRRVEELARTIPGAVWLNQYANPDNWRAHYHGIGAEIVRDMPAEPTHVVAAVS
TCGTLMGLARRLRERWPRISVVAVDLDGSVIFGAPGGRRDIPGIGASRVPEQLSLSEVDS
VIYATDWESTLGCRRLAETQGILAGGSSGTVVAAITKLIPHLPPGSRIVTLLPDRGERYL
DTVYNPAWPPADRRRSISFEASYRPLGTRAAAA
 
last changed 2014/07/04 15:05

B6db sequences