Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.017248923

WP_017248923

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Brevibacillus brevis
GB WP_017248923
SQ
MHSLASTLNQTIQRENPHVYEMLSDIAKLIYFPKEGILSQSAEAKAKAKKYNATIGIALE
NGQPMHLKVIQDNLSAYQPKDIYEYAPPAGKPELRAAWRKKMIEEQPSLATHTFSNPIVT
NALTHGLSIVSDLFADSGDSVIIPDKNWENYELTFSIRRGAEMVYYPLYNDEMKFNAAAL
RDAILAQKDKGKAIVVLNFPNNPTGYTPGPEEGKQIVAALKEGAEAGINIVAVTDDAYFG
LFFEDSMHESLFASLCDVHPRILPVKVDGATKEDYVWGFRVGFITYASPSSDLLSALEQK
TMGIIRATLSSGSHPSQTFVLHAITAPEYKAQKQEKFDIMKGRANRVKEVLDSGKYADVW
TYYPFNSGYFMCLKLKTVEAETLRQHLLEQYGVGTIALGQTDLRIAFSCIEEENIADLFD
LVYSGVKDLENAVTK
 
last changed 2014/03/04 12:17

B6db sequences