Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.017815619

WP_017815619

Description hypothetical protein
Activity 2.6.1.90
Family 2.6.1.90
Evidence ISS - similarity
Phylum Bacteria
OS Paenibacillus sp. A9
GB WP_017815619
SQ
MIQFLDLKKINLRHEQAIQESVAQVLHSGWYILGEQVKSFEAEFASYCGTRYCLGVANGL
DALELIIHAYGISEGDEVIVPSNTYIASILSISANGATPILVEPDPQTYNIDPAKIEEKI
TEKTKAIMVVHLYGQTCDMQPIRELAQRFDLKIIEDCAQSHGALYADQRAGNLGDAAAFS
FYPGKNLGALGDAGAITTNDEELYTKLYALRNYGSHKKYENLYKGYNSRLDEFQAPILKE
KLKHLDADNAYRRDIANYYIEHIHNTLITLPIVKHNPESHVWHVFVVQVADRADFMQYMT
DNGIQTIIHYPIPPHKQQAYAEWNDHVYPISEEIHKHIVSIPISPVMPMEEVMKVVEVIN
EYGQN
 
last changed 2014/02/24 11:43

B6db sequences