Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.018352138

WP_018352138

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17b
Evidence ISS - similarity
Phylum Bacteria
OS Longispora albida
GB WP_018352138
SQ
MFMELVTIGEIEAAVTAIAGTAVRTPLLPSPWADADRLLWLKPENLQPVGSFKIRGARNA
IRPGVPGVVTHSSGNHGLAVSYVASRLGIPVIIVAPDTTPEVKLAAMRDSGATVLTVPPE
ERLIRAEGVAAARGYPIIPPFDHRDVIAGQGTIGHEIATDLPGVRVVLVPVSGGGLASGV
GTAIRALAPQATILGVEPELAADAAESLRAGRIVAWPVADVQRTIADGLRNPSLSDLTFA
HLRTVLDGIITVTEEEIRAAMGVLARRSRLVAEPSGAVATAAYLYHREEMPTGDTVAIVS
GGNVDPALLKSVV
 
last changed 2014/03/05 15:09

B6db sequences