Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.018428981

WP_018428981

Description hypothetical protein
Activity rhizomimosinase
Family rhizomimosinase
Evidence ISS - similarity
Phylum Bacteria
OS Hoeflea sp. 108
GB WP_018428981
SQ
MEIDRLGDPDLLSFGTADLDFRSPPAVVEALHRAVDAGHFGYPLRRPGYYDAVTGYLSRR
FGWQVEKTWIDSCVAIYPSMHSIIMELTQAGDEIIYQPPVHHVFAEIVKANDRVPVANQL
INRGGTYEMDFAGLEACITDRTKLLLLCSPHNPVGRVWTRDELKELARICSERGVIVVSD
EVYSGMLYEETEFTPFAAVSEWAAMNSYCLLSPSKPFNLTGLKHSIVVTPSPVLRDAFRR
GLLRANLQYGGSVLGYAAAEVAFRDCDDWSHALMRHVAGNHAYVTDLIQSFLPEVRVPVA
EAAYFAWLDLSGLNTPKAVYEPLIERQAKLVVTYGEPMGPGGENHIRINLGTSRSILEAG
MRRLLSVLVPLTGRSFDESAC
 
last changed 2014/03/11 11:33

B6db sequences