Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.018682497

WP_018682497

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17b
Evidence ISS - similarity
Phylum Bacteria
OS Actinokineospora enzanensis
GB WP_018682497
SQ
MPPTRDAFARLAQGELRDTAQSIVDLAAPVHTGWVNLVTLADITAAAERIAGTAVRTPLV
PCPWADRPLWIKPESLQPVGAFKIRGAYNAIARIDAATRARGVVAYSSGNHAQAVAYAAK
VFGIPAWIVVPEDTPTVKVEATRAHGAEVVLSAVGQREAVAYEIVERENATLVPPFDDPG
VIAGQGTIGLEIVADLPDVDLVLAPVSGGGLISGIAAAVKALRPEAQVWAVEPELAADTA
ESLARGERVSWSVADRNRTIADGLRSQPSELTFAHQQALVDGIVTVSEDEIRDAVAVLAH
RARLIAEPSGAVATAAYLHHADRLPPGKTVTILSGGNLDPTTLADLLKA
 
last changed 2014/03/05 15:05

B6db sequences