Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.018885554

WP_018885554

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Paenibacillus massiliensis
GB WP_018885554
SQ
MNSLAEQLNHTLHTEQVHVYEMLSTLGKEIYFPKEGILSQSAEAGKLAQKYNATIGIATE
QGGPMHLSVIQEKLSAFQPKDLYPYAPPAGKPELRTAWRSKMLVENPSLQHKSFGTPIVT
NALTHGLSIVADLFADEGDAVIYPDKNWENYELTFGVRRHARLVNYPLFTEDMRFNSQGL
REALMAQQEQGKAIVLLNFPNNPTGYTPGLEEGNEIVAAIRDAAEAGINVVVVTDDAYFG
LFFEESLQESLFGKLANIHPRVLAVKIDGATKEEYVWGFRVGFITYASDSSEVLSALEQK
TLGIIRATISSGPHPSQTFVLDALQSPEFEAQKAEKFAVMKGRANKVKALLDTGKYDDAW
EYYPFNSGYFMCLKLKKVHAEELRTHLLQQYGVGTIALGEHDLRIAFSCIAEEYLEDLYN
LVYQAYQDLV
 
last changed 2014/03/04 12:10

B6db sequences