Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.019119482

WP_019119482

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Brevibacillus massiliensis
GB WP_019119482
SQ
MHPLAKQLNETIQRENPHVYAMLSELGKQIYFPKEGILSQSAEAKAKANKYNATIGTALE
NGKPMHLKVIQDTLSAYDPKDLYEYAPPAGKPELRAAWRKKMIEENPSLEGKTIGNPIVT
NALTHGLSIVADLFAGPGDSVIIPDKNWENYEITFGVRRGAEIVNYPLYNADNKFNAEGL
RDAILAQKEKGKAIVILNFPNNPTGYTPLVEEGKQIVAAIKAGAEAGINVVAVTDDAYFG
LFFEDSLHESLFGALSDLHPRVLAVKVDGATKEEYVWGFRVGFITYAGQSDAFLAALEQK
TMGMIRSTISSGPHPSQTFVLHALNAPEFNAQKQEKFSIMKRRANRVKELLDSGKYDGAW
EYYPFNSGYFMCLKLKTVDAESLRVHLLNEYGVGTIALGETDLRVAFSCIEEEQIDDLFE
LIYRGVKDLENVAAR
 
last changed 2014/03/04 12:12

B6db sequences