Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.019153592

WP_019153592

Description hypothetical protein
Activity 2.6.1.1
Family 2.6.1.1.b
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus massiliosenegalensis
GB WP_019153592
SQ
MNEIARQLNETILKYNPNVYQMLSELGRNLYYPKGILSQSAEASKLATRFNATIGIATDK
KHPMHFKHIQKNLNDYSPEDIYPYAPPSGKQKLRNEWKKKLLRENPSLQSKTMGDPIVTN
ALTHGLSTTADMFVDQNDSIIVPDKYWGNYQTIFHIRRGGVLKTFPLFNEDDEFHISAFR
QCVMGQKDSGKAVVVLNFPNNPTGYTPYGREVEGIISALLEGANAGINIVLILDDAYFGL
FYENSIQESLFGKIAGLHPRILTIKIDGATKENYVWGLRVGFITFAAENKTILEALEQKT
KGLIRGTISSSSHLSQTIILHSLQSSEFEKEKLEKYNVMKKRAKRVKEIVRRERYKRSWN
FYPFNSGYFMCLKLLKVNAEELRIHLLNEYGVGTVSINSTDLRIAFSSVEEEYLEELFEF
IHQGIQDLLKEGV
 
last changed 2014/03/04 12:18

B6db sequences