Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.019167715

WP_019167715

Description hypothetical protein
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Staphylococcus intermedius
GB WP_019167715
SQ
MTLRSSSIFNFRNNIQELKKQNEIHANKYLSSEINITNQNLSENKHIQKIEFMPVNRLIR
EDETEKIIKTLKDFLPTGKYTSGKYIDEFEHYLSEYLSINHVIALSSGTAALTIGLLSLG
VTAGDEVILPSNSFAATENAVVSIGATPVYADVKDDFTICPKSIENLITSKTKAILPVHL
YGRFCDMLKIQKIASEYDIKVIEDACQGIGLEEVGMYSDLAALSFNPYKNLGVCGKAGAI
ITNNTELDYKCRLISYHGFDLKEKNKKIIDFGFNSKIDNTQALIGIVRMEYLTFNQYRRL
KIAEKYNEKLSDMENIILPTFDDKSVWHLYPIRIKNNKRDFVKSELEKVGIQSEIYYPYL
SHKQISYKKIISLPNTERIHKELLCLPLYPGLTKEEQEYVISKLREILEGLRCQGI
 
last changed 2014/02/21 12:07

B6db sequences