Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.019415891

WP_019415891

Description hypothetical protein
Activity 2.6.1.90
Family 2.6.1.90
Evidence ISS - similarity
Phylum Bacteria
OS Paenisporosarcina sp. TG20
GB WP_019415891
SQ
MITFLNLKKVNAQYENELKEAAARVIDSGWYILGQEVKEFEQEFADYCGVKHCIGVSNGL
DALKLILKAYGYGPGDEIIVPSNTYIASILAISEVGATPILVEPNFNTYNINPSQIEKFI
TKNTKAILVVHLYGRSVDIDTIQKIADRYHLKVIEDSAQAQGAIYKGRKTGSLGDAAGFS
FYPGKNLGALGDAGAVTTNDSKLANDIYTLRNYGSHKKYENIYKGYNHRLDEMQAAFLRV
KLKYLDKENQVRREIAKEYLTSINNPLITLPSVSKHMLENVWHVFVIRTAERDRLQSYLT
NQDIQTVIHYPKPPHLQEAYKEMNSKKYPISEQMHKELLSLPLSPVQSKVDTKKIIEVVN
HFR
 
last changed 2014/02/24 11:53

B6db sequences