Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.020253972

WP_020253972

Description hypothetical protein
Activity kdna
Family kdna
Evidence ISS - similarity
Phylum Bacteria
OS Cloacimonetes bacterium SCGC AAA255-B16
GB WP_020253972
SQ
MPGFEIFGEEEKKEVLDVLETGVLFRYGFDNARNGHWKTKSFEKELCYITGAGFSHLCSS
GTAALCVAMVSCGIGAGDEVIVPPFTFVATLESVLNIGAIPVFAEIDDTLCLDPEKLEDF
ITEKTKAVLPVHMCGSMAKIDRIKEVCDKNNIVLIEDACQSIGGTFHGTALGRFGKAGCY
SFDAVKTVTCGEGGGIITDEKKIYDNIHMYADHGHDHIGNDRGLENHPFLGMNYRISELN
AAVGLAQLRKLPEMIKIQKRNKKMFKDALKEIDEVSFRNIPDEDGDTATFLSIFLPDEKR
ARDIAGKLAKAGVAGCPYWYDNKWHYIKKWDHLINLSALAKLPIHKYENHPDYRNIKLPQ
SDNIMKRTISMQIMLNWTESEIEERIDKIIGVFK
 
last changed 2014/03/04 11:27

B6db sequences