Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.020502191

WP_020502191

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17b
Evidence ISS - similarity
Phylum Bacteria
OS Sciscionella marina
GB WP_020502191
SQ
MKLVDSTSIAAAADRIAGSVVRTPLLPSFLGEADRELLLKPENLQPIGAFKLRGAVNAIR
SLDRPNGVVAYSSGNHAQAVAYAAKLAGLPAVIVIEETAPARKIEATRSHGAEVVLTDPE
ERESTAHRLAAEREYPLIAPFDDPAVIAGQGTIGSEIAEDAPDIAAVLVPISGGGLASGI
AAAIKAHRPKALVYGVEPELAADTRESLEAGVIREWSRAERGRTIADGLRSTPSELTFAH
LRAHLDGVLTVTEEQITGTVRRLALEARLIAEPSGAVAPAAFLHHGAALPQGRIAAVVSG
GNINPVLLGRLLTDTHAR
 
last changed 2014/03/05 15:09

B6db sequences