Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.022475433

WP_022475433

Description putative uncharacterized protein
Activity cys.hydrolase.
Family cys.hydrolase.
Evidence ISS - similarity
Phylum Bacteria
OS Ruminococcus
GB WP_022475433
SQ
MNTVYESRFDKISGMIGKTPLLEIHFTYKGEPRRIFAKAEYFNLSGSIKDRVAFHIMKKA
YEKGEIAPDDIIAEATSGNTGIAFSAMGSYLGHKVVIYMPDWMSAERINLMKSFGAEVRL
VSREEGGFLGSIAMTEKLAEGGGVFLPRQFSNEDNTETHYLYTGEEISRQLAAMGLKADG
IVAGVGTGGTVMGIGRRLRKDNADCKVFPLEPLNSPTLSTGYRVGKHRIQGISDEFIPDI
LKLDETDAVVSVDDIDSIIMAQMLSRKFGIGVGISSGANMLGCILAQEKLGKDSTIVTVF
ADDNKKYLSTDYSEEFEVKEEYLTHDIVLTDVIAHRYE
 
last changed 2014/02/21 11:21

B6db sequences