Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.024569183

WP_024569183

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Cupriavidus metallidurans
GB WP_024569183
SQ
MVCNSIIESIGNTPLVQLRRLFGRADAEVFAKLELFNPAGSVKDRPARYIVEKGLAEGAI
GPHSHVIESSSGNLAIALAMICGLKGLRFTAVVDPKISPTNLKILRCYGAGIEQVTAKDS
QGGYLETRIERVRQMLREQRDAIWINQYANPLNWESHYYGEAAEILAQLAQPADVLVLGV
STSGTVHGIARRLRKAWPSMRVVGVDAVGSVLFGQPSQARELPGIGASRVPELLCRDEID
EVIHIDDYTAATACRRLLAREGIFAGGSSGAVVAAIEQVLHATPVSHRPLRILTLFPDRG
ERYLDTVYDDTWLARIAARRAVPNLAALPTVASLIPAGVSA
 
last changed 2014/07/04 15:01

B6db sequences