Activities | Families | Sequences | Fold types | References | Help
B6db sequences: wp.029099330

WP_029099330

Description Siderophore biosynthesis protein SbnA
Activity sbna
Family sbna
Evidence ISS - similarity
Phylum Bacteria
OS Brevibacillus thermoruber
GB WP_029099330
SQ
MECNRTSPPVSDSIAACVGNTPLVHLKRLFSGSQVDVFAKLELMNPGGSMKDRPARYIIE
QGLKDGTIHEKTHLIESTSGNLGIAISMMARVHGLTFTCVVDPKITKTNLAILKQMGARI
DMVQEPDDQGGYLKTRIRRVQELLQTTPNAYWINQYANENNWKAYYYGTASEILEQVSGS
IDYLVMAVSTTGSILGTARRIREAYPHVKVIAVDAVGSVIFGAPPAPRELPGIGSSRVPE
LLRREEIDEVVYVNDAESVSGCRDLLAAEGIFAGGSSGSVIAAIRKIIASVPAASRVVTI
LPDRGERYLDSVYDDAWVQKLSRPTVSV
 
last changed 2014/07/04 15:19

B6db sequences