Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.001212195

XP_001212195

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Fungi
OS Aspergillus terreus
GB XP_001212195
SQ
MANSTTPQEPWIETPIIESATLSRAAGCRVFLKLELLQPSGSFKSRGIGNFIRTALLNPT
NNGKNLHFYISSGGNAGLAAVIAANDLGCPCTVVVPHSTKPLMINKLHAAGATEVIQHGA
SWVEADSHLRETFIDHQEGKQTNIYIPPFDHPDVWAGAATMVSEIAAQVPPRDSSGCAFP
ADAIVCSVGGGGLFNGIVQGLDEYLRSHEAADKTGNVQVLAVETQGADSLAHSLRAGRLD
SLPAITSLATSLGARCVSAQTFKYAQSSPAGINVVSVVGSDAEAARGVVTLADEQRLQVE
LACGINVDVVTGEKFKQAVPDLTPESRVVVVVCGGSNVTAEMIAEYRQKLQDGWK
 
last changed 2014/03/05 15:21

B6db sequences