Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.002266398

XP_002266398

Description predicted protein
Activity serine.decarboxylase
Family serine.decarboxylase
Evidence ISS - similarity
Phylum Viridiplantae
OS Vitis vinifera
GB XP_002266398
SQ
MVGSALFEAMSGDLGGKVEILSEDFDPTAVVVEPVPPVVENGGEMGREEEEKRSKEIVLG
RNVHTTCLAVTEPDANDEFTGDKEAYMASVLARYRKTLMERTKHHLGYPYNLDFDYGALS
QLQHFSINNLGDPFIESNYGVHSRQFEVGVLDWFARLWEIEKDEYWGYITNCGTEGNLHG
ILVGREVLPDGILYASQETHYSVFKAARMYRMECVKVATSLSGEIDCADFKAKLLANKDK
PAIINVNIGTTVKGAVDDLDLVIETLEECGFTHDRFYIHCDGALFGLMMPFVKRAPKVTF
KKPIGSVSVSGHKFVGCPMPCGVQITRMEHINALSRNVEYLASRDATIMGSRNGHAPIFL
WYTLNRKGYKGFQKEVQKCLRNAHYLKDRLRDAGISAMLNELSSTVVFERPVDDEFVRRW
QLACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDL
HK
 
last changed 2010/10/04 15:50

B6db sequences