Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.006303797

XP_006303797

Description hypothetical protein
Activity 1.4.4.2
Family 2.6.1.88.a
Evidence ISS - similarity
Phylum Viridiplantae
OS Capsella rubella
GB XP_006303797
SQ
MAPASSPLPISSESDEKYANVKWEELGFALTPTDYMYVAKCKEGESFSQGKIVPYGDISI
SPCSPILNYGQGLFEGLKAYRTEDDRIRIFRPDQNALRMLTGAERLCMTPPSLDQFVEAV
KQTVLANKKWVPPPGKGTLYIRPLLIGSGASLGVAPAPETTFLVYASPVGGYHKVSSGLN
LKVDHKHHRAHSGGTGGVKSCTNYSPVVKLLLEAKSSGFSDILFLDAATGRNIEELSACN
IFIVKGNIVSTPPTSGTILPGVTRKSISELARDIGYQVQERDVSVDELLEAEEVFGTGTA
VVVTAVETVTFHDKKVKYRTGEAALSTKLRSMLTNIQMGIVEDKKGWMVEIDRCQG
 
last changed 2014/02/20 13:57

B6db sequences