Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.006393181

XP_006393181

Description hypothetical protein
Activity 2.6.1.88
Family 2.6.1.88.a
Evidence ISS - similarity
Phylum Viridiplantae
OS Eutrema salsugineum
GB XP_006393181
SQ
MAPSVQPSSSPLRTSEGDEKYANVKWEELGFALTPTDHMYVAKCRQGESFSQGKIVPYGD
ISISPCSPILNYGQGLFEGLKAYRTEDDRIRIFRPDQNALRMQTGADRLCMTPPSVELFV
EAVKQTVAANKKWVPPPGKGALYVRPLLIGSGAILGVAPAPEYTFLIYASPVGDYHKVST
GLNLKVDHKYHRAHSGGTGGVKSCTNYAPVVKSMVEAKSSGFSDVLFLDAATGRNIEEVS
TCNIFIVKGNIVSTPPTSGTILPGVTRKSMIELARDIGYQVQERDVSVEELLEAEEVFCT
GTAVVVKAVETVTFHDKKVKYRTGEAALSTKVHSMLTSIQIGLVEDTKGWMVEIDRCQG
 
last changed 2014/02/20 13:59

B6db sequences