Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.503774

XP_503774

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Fungi
OS Yarrowia lipolytica
GB XP_503774
SQ
MRPGYIETPLLKNDIFSHQVGCNVYLKMENLQPSGSFKSRGMTQVISDALDSDPQASLDT
LHVCSSSGGN AGLAAAVTSRLNGVACTVVVPESTKPRMVEKLRAAGAEVIVHGKHWSEA
NDFLQKEEMPRLEKTGKTPIY CHPFDAPAVWKGNSTLIDEIIKQGITPDAVVCSVGGGG
LFNGVVEGLKRHKLNCPVIVVETNGADALSRS LQKGEQVTLPGITSIATSLGAVRVADK
TFENAQTYPTVSAVVSDDDAVSALVEYAETKQIIVEPACGASL AVLPALKDLVDLKPDS
NVVVVLCGGSATGISDIAQFKKDLEAKETTEEK
 
last changed 2014/03/05 15:21

B6db sequences