Activities | Families | Sequences | Fold types | References | Help
B6db sequences: xp.775525

XP_775525

Description hypothetical protein
Activity 4.3.1.17
Family 4.3.1.17a
Evidence ISS - similarity
Phylum Fungi
OS Cryptococcus neoformans
GB XP_775525
SQ
MAAVNYTIEDPNTVPWIKTPLVRSAALSKLAGCEILLKLENIQPSGSFKSRGIGNLVLQS
VNSAPPDTPLHFYSSSGGNAGLACVNAASTLGYPSSVIVPLSTKPFMIDKLRTAGATEVI
QTGQTWFEADKHLQEEILARDPNGIYVPPFDHSDIWQGAATMVDEIVQELTHVPDAIVCS
VGGGGLMIGVCKGLERLDKEKKAKVVAVETLGAESLHKSVKAGQLITLPGITSLATSLGA
TTVAAKALEYALQPQVRSTVVSDKEALEACIRFLDDERILVEPACGATLAMVYSGKLKDV
LKLDAKSKVVLVVCGGSNISLELIEGYKKMF
 
last changed 2014/03/05 15:21

B6db sequences