Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.001321852

YP_001321852

Description pyridoxal-5'-phosphate-dependent protein subunit beta
Activity cys.hydrolase.
Family cys.hydrolase.
Evidence ISS - similarity
Phylum Bacteria
OS Alkaliphilus metalliredigens
GB YP_001321852
SQ
MYSRCVEDRIKDLSNLIGNTPLLEIEFTYKGERRRIFAKAEHYNLTGSIKDRMALHIIKK
GYESGELKVGDIIAEATSGNTGIAFSAIGSSLGHNVTIFMPDWMSEERKNLMKSYGADIQ
LVSKEQGGFLGSIAMAEEFAKDNENVFLPCQFSNENNCQAHYLTTGPEIWTQLQDLNLIP
DGIVAGVGTGGTIMGIGNYLKEKNPDVKVYPLEPISSPTLTTGYKVGNHRMQGISDEFIP
SIVKLNELDEVIAVDDGDAIIMAQKLANALGIGVGISSGGNFLGALRVQEILGKECIIVT
IFSDDNKKYLSTDLMKKEPIKEGFMSTEVELISVISHKRQCVTCLAK
 
last changed 2014/02/21 11:23

B6db sequences