Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.001863711

YP_001863711

Description rtxA-like protein
Activity dihydrorhizobitoxine.synthase
Family dihydrorhizobitoxine.synthase
Evidence ISS - similarity
Phylum Viridiplantae
OS Burkholderia phymatum STM815
GB YP_001863711
SQ
MTVPHHFLLTPGPLTLSDEVRAQMQYDVGSRDACFKTITAQVRNIIVDLVDGRDAYSVIP
MQGGGSYGIEAALASFVAPSDRPLVCINGIYGERMLKMLQLRGVHVVSMTAPCDEPLSTS
KIAEYLRRNPAVTHLCFVHCETTTGVINPLRPIVELAKKHGVRTIIDAMSSFGAVEISAK
QVQFDVLVTSSNKCIEGPPGVSFVIASLEMLNSRVKHMNSFVLDVRDQWNSFEKSGEWRS
TPPTHVIQACAKALERLTIEGVFRRGERYRSVRDAIIGATAPYASPLLNAKIRSPVCLAL
TAPNVIRTQKDLDALYAHLVDYNLYIYTKLHSQTRSFRIGCMGRIDLMWIRLLEIAFQDF
FDANRGVRKYLSASKNRSVEKVL
 
last changed 2014/02/25 10:54

B6db sequences