Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.002750595

YP_002750595

Description degT/dnrJ/eryC1/strS family protein
Activity ntda
Family ntda
Evidence ISS - similarity
Phylum Bacteria
OS Bacillus cereus
GB YP_002750595
SQ
MKTLTTISGHSKDNLALLKCLQGETKEKEFEISNILPNHKMKEKLFRENKLKIDIDIEKD
IFNYSRKNIQKIEFMPVNRLISQDEVEKIIGVLKDVLPTGQFTSGPFSKKLEEVIGSYLN
KKFVIATSSGTDALMVSLLSIGIQPGDEVIMPANSFAATENAVLAVGAKPIFVDIDQKSY
CIDPSKIEEAITPKTKCILPVHLYGKQCEMKKIREIADIYQLRVIEDACQAIGSSNLGEY
GDIIVLSFNPYKNFGVCGKAGAIVTDNETLAIRCNQYSYHGFEIDKKNKKVLDFGFNSKI
DNLQAAIGLERIKYLSYNNLKRVYLAQRYIRELKDLEDRGLIKLPMMTEDNVWHLFPIRV
ENGRRDELKNKLYQLYNIETDIYYPVLSHKQNTKWIKENDLQNNMFNTEQVHKEILHLPL
HPNMMLEEQNFVLEGLFNVNK
 
last changed 2014/02/21 11:57

B6db sequences