Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.006760124

YP_006760124

Description DegT/DnrJ/EryC1/StrS aminotransferase family protein
Activity kdna
Family kdna
Evidence ISS - similarity
Phylum Bacteria
OS Desulfobacula toluolica Tol2
GB YP_006760124
SQ
MPGFEIFGDEEKKEVTDVLETGVLFRYGFEGTRNGHFKALEFEKKLCEITHAKYSHLCSS
GTAALSISLAACGIGAGDEVIVPPFTFVATFEAIINAGAIPVFGEIDETLCLNPDKLEDI
ITSKTKAVVPVHMCGAMARIDEIKDVCTKKGLILIEDACQSLGATYQKKAIGTFGLAGCF
SFDSVKTVTCGEGGGLITDSKTVYEKADQFADHGHDHLGGPDRGADDHPIIGTNFRISEL
NAAVGLAQLNKLDQILDIQKKNKHAIKDAMADLPEVGFRYLPDAKGDSATFLSFFLPTEA
RTRQVAKNLADNKVGCAYWYDNNWHYYKKWHHLKEMKRSAKLCVELADDLPDYKNLVLED
SDNIMKKTLSMQIMLSWTQEDIENRIQAIIKSFKG
 
last changed 2014/03/04 11:28

B6db sequences