Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.006836508

YP_006836508

Description hypothetical protein
Activity dihydrorhizobitoxine.synthase
Family dihydrorhizobitoxine.synthase
Evidence ISS - similarity
Phylum Viridiplantae
OS Burkholderia phenoliruptrix BR3459a
GB YP_006836508
SQ
MSRNIANVQMSRETALLYAGYRHDPVTKAVSVPIYQSTAYELEGDLEKIAGIYNAKEDGF
TYSRIINPTTRILEKRFAAVESASDSLAVASGQAATFLAIANLCSGTPGDNVVASKYLYG
NSWNLLFNTFKRLGIEARCADPKNISSFELLTDDRTIAIFGEAFSNPCLVPLPIAALAAI
GKRHGVPVIVDNTTTPLICRPASLGASISTYSATKYLCGHGTTLGGLIVDNGRFAFDDTV
RFPLFNEPDEAHGGILWKEAVLKLDDLGASPYLLKARMTWLRDTGAAISPFSSFQLIQGL
ETLHLRMQRHCENALAVAEFLIKHPKVKRVSYPSLSYGYERELVDELVDASVGYGAIIMF
ELADEAAGRRFITNIDLMYHVSNVGDARTLVTHPVSTTHTTVPKEQREAAGIFDGSIRLC
VGIENVDDIVADIQQGLDAV
 
last changed 2014/02/25 17:00

B6db sequences