Activities | Families | Sequences | Fold types | References | Help
B6db sequences: yp.504383

YP_504383

Description pyridoxal-5'-phosphate-dependent enzyme
Activity cysteate.synthase
Family 2.5.1.76
Evidence ISS - similarity
Phylum Archaea
OS Methanospirillum hungatei JF-1
GB YP_504383
SQ
MTGYTLTCPVCNKEFSDSYTLTCPGGCQGLIRAKYAARQITLHDAPGVFKYMDWLPVTGV
LRTRAEPVCFKSEGLARALGLSDLWIVFSGYWPEVGAFAVSGSFKEFEAFPTMQRLSERT
KGIIQVSSAGNTGRAFAEVSAETCQPVIIVVPESARDRLFTTSPAHDTLLITISGDYTDA
INLGSRICTLPGIFPEGGAKNVARRDGMGTVMLAGTLAMGTLPDWYLQAVGSGTGGIAAY
EASLRLIADGRFGTRMPRLLLFQNEPFIPMVRAWQEKRREIKDEDMPDAEQAISQVYSDV
LTNRTPPYGIVGGVFDTLIATNGLMAGVSSADAQEAGKLFSSSEGIDPDPAAAVCVAGLM
RAVRSGVIKPDEKILLNITGGGYARGRKDLPRFVKAPDIMVSKETPFEKISAKVQEWMRY
YA
 
last changed 2010/01/12 13:07

B6db sequences