Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00009535

ZP_00009535

Description hypothetical protein [Rhodopseudomonas palustris]
Activity o.succinylhomoserine.sulfhydrylase
Family o.succinylhomoserine.sulfhydrylase
Evidence ISS - similarity
Phylum Bacteria
OS Rhodopseudomonas palustris
GB ZP_00009535
SQ
MSESKPTIPVPATAHFRRETRLVHSGSLRSQFGETSEALFLTQGFVYESAEQCEARFTGD
DAGFQYSRFSNPTVFSFEQRMAEFEGAEAARSTATGMAAVTAAMLAPLRAGDHVVASKAM
FGSCRYVVEDLLPRYGIESTLVDGLDLDQWQRAVRPNTKTFFLESPTNPTLDVLDIGAIA
EIAHAAGARLVVDNVFATPIWQSPLQLGADVVVYSATKHIDGQGRCLGGVVLSSQAFIEE
HIQMYLRQTGPSLSPFNAWVLLKGLETLAVRVEKQTSNAAAIADALAGQPKVPRLVYPGR
ADHPQAATVKKQMGAGSTLVGFEVKGGKAEAFRFLNALKLVKISNNLGDAKSLVTHPATT
THQRLKPEARAELGISEGFIRLSAGLEHKDDLIEDLLAALDKV
 
last changed 2005/03/16 20:04

B6db sequences