Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00015182

ZP_00015182

Description hypothetical protein [Rhodospirillum rubrum]
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Rhodospirillum rubrum
GB ZP_00015182
SQ
MSDFDPALAGGLSRAELEAHWMPFTANREFKANPRMVVGAEGVHYIDARGRKLYDSLSGL
WCCGAGHGRREIIEAVSAQIAALDYAPAFQFGHPSSFKLANKVASLTPKGLDHVFFTNSG
SESVDTALKMARAYWRLKGEPARTKLIGRAKGYHGVNFGGLGVGGIGGNRKLFGVGIDAD
HLPHTMLPENAFTKGCPETGAELADALEDLVALHDASNIAAVIVEPLAGSTGVLPPPKGY
LQRLRAICDKYGILLIFDEVITGFGRMGAAFGADAFGVVPDIMTIAKGLTNGAVPMGAVV
ASGEIYRTFMENSGPDHLVEFPHGYTYSAHPVACAAGLAALEIFEKDQLAARAAALAPYF
ENSLHGLRGLKHIVDIRNYGLAGAVQIENAPGQPAKRPLEIGRKCWEAGYYVRFGGDSLQ
FGLPFFSEPAQIDGLMNAVADAVSSVA
 
last changed 2010/01/08 13:04

B6db sequences