Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00035195.1

ZP_00035195.1

Description hypothetical protein
Activity 2.6.1.37
Family 2.6.1.37
Evidence ISS - similarity
Phylum Bacteria
OS Enterococcus faecium
GB ZP_00035195.1
SQ
MYFKKEMKGNHMYKLLTSGPLTTSETVKNAMLIDHCTWDQEYKEITQWIRKKLLDLAQVS
EGIYTTVLMQGSSSFGVESVLSSVIRPEDTVLICSNGAYRQRMINMCECLKLNYTVYEVS
EHQILQAHVITQLIEENPSISALAMVHSETTSGILNNLEEIAAVTQERDLLFIVDAMSSF
GGIPICVAELGIDFLISSSNKCIQGVPGFSFVLANKAELEKRKNVSRSLSLDLYDQYRVM
ENENGKWRFTSPTHTVLAFQQALKELEAEGGIETRYSRYLANNHVLRQKMTEMGFQPFIQ
EYQGPFITSFLYPKDWRFDFNHFYQYLKQNGFVIYPGKISDHECFRIGNIGEIYPEDILE
LTAIIKDYKENVNV
 
last changed 2005/03/16 20:04

B6db sequences