Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00061646

ZP_00061646

Description Branched-chain amino acid aminotransferase (EC 2.6.1.42) (BCAT).
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Clostridium thermocellum
GB ZP_00061646
SQ
MSYQISIQKTQNPKNKPDQDNLGFGQIFTDHMFIMDYTEGKGWHDPRIVPYGPLSLEPST
MVFHYGQAVFEGLKAYKTEDGRILLFRPRKNMERINISNERVCIPKIDVDFAVEACKTLV
SVDRDWIPEAEGTSLYIRPFIISTDPFLGVRPSWTYKFIIILSPVGAYYKEGINPVKIYV
ESEYVRAVKGGTGYAKTPGNYAASLIAQVKAKELGYTQVLWLDGVEKKYIEEVGTMNVFF
KINGEVITPSLDGSILAGITRESTIELLRASGIKVTERKITIEEIYNAHEAGTLEEAFGT
GTAAVISPIGELSWNGKVIKINDGKIGETASFVYNTITGIQSGKIEDKFGWTVEVK
 
last changed 2005/03/16 20:05

B6db sequences