Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00064168.1.

ZP_00064168.1

Description hypothetical protein
Activity 4.1.1.64
Family 4.1.1.64
Evidence ISS - similarity
Phylum Bacteria
OS Leuconostoc mesenteroides
GB ZP_00064168.1
SQ
MIEAFEKSQEPWADVEKYVGRYAGMDFSPDIVDHAKGTYLFTESGEKILDFTSGQMSSTL
GHSNPEIVTTLQQTVQRLDHLYSGMLSRPNINLSKNIASKTGENLKKVIPLSTGSEVNEA
ALRMAKLVTGKFEVVSFNKSWHGVTQASAGATYASARKSGAPTSPGQLSIPTPYTYRPNF
FNSEGEYDWHKELDYGFEMVDAQSVGSLAACIVEPIVSGGGILVPPKGYLAALKEKCRER
GMLLIFDEAQTSLGRTGEWFAYQYDDVEPDILTLSKTLGSGLPLAALVTTDKIEKKAHEK
GFLFYTSHVNDPLVAAVGCTVMNIIERDNLCQVTKEKGNYLHDGLQKLVDEYDIVGDARG
RGLLQGLEIIKSKSNKERSEFIGDEITKRCYKLGLHMNIVNLPGMGGVFRIAPPLTVSYE
ELDSGLAILEQSIKSVQNDINLGNL
 
last changed 2005/03/16 20:05

B6db sequences