Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00068284

ZP_00068284

Description hypothetical protein
Activity 2.6.1.66
Family 2.6.1.66
Evidence ISS - similarity
Phylum Bacteria
OS Microbulbifer degradans 2-40
GB ZP_00068284
SQ
MPSFPLSPFGERLSAPAGIVSLMDDLGEALNVNPDILFLGGGNPARIPEMEQAFAQALQA
ISANPEQLHKMLGVYQSPRGHEGFIERLVPFLNERCGWSITSKNIALANGSQSAFFILLN
MLAVPATANTPAQKIHLPMAPEYLGYSGQTVAPDMFCAHKPLIELVEGNQFRYRVDLATL
ANTQNVAAYCVSMPTNPTGNVLARSEVEALQVLAAEQQVPLILDCAYGAPLPGIVYQEVA
LPWSDNSVYMFSLSKLGLPGARTGIIVGPEELVEQFVNANTVASLANGNAGPALAEALMA
QGQLEPLIQHTVTPFYLAKRNHMLGALEQALAGLPCRVHCADGAFFVWLWLQDLPISAHA
LYLQMKAEGVLIMPGEPFFFGLDAPWDHAEQCIRLSYCQSDEVIVKAVTILGRVLRKAYG
A
 
last changed 2005/03/16 20:04

B6db sequences