Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00071333

ZP_00071333

Description Probable branched-chain amino acid aminotransferase (EC 2.6.1.42)
Activity 2.6.1.42
Family 2.6.1.42
Evidence ISS - similarity
Phylum Bacteria
OS Trichodesmium erythraeum
GB ZP_00071333
SQ
MQIVNSQISIEKTSHSRIKEQDINNTPFGKVFSDHMLVATYANNSWQEVKITPYGNISIR
PSLSVLHYGQAVFEGLKAYKNYQGKPVLFRLEANYKRINNSAFRLCMPSIPKEIFIDGLK
ELIRLDTDWIPTKSDSALYIRPIYFATDESVGLKPANSYKFIILSSPTGTFYSAPVKLIV
TDKYVRASEGGTGAAKCAGNYAGSFLADKEAKEQGYDNVLWLDGKEKKYIEECGTMNVAF
VINDVLITPKLTGSILGGITRDSALTLFRDMGVKVEERLISIDEVAKAYEAGNISEAFGM
GTAATIAHISVINYQGKDMILPPVDERKYASQVLQKLEDIKTGKVTDPYGWICQL
 
last changed 2005/03/16 20:05

B6db sequences