Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00083884.1

ZP_00083884.1

Description hypothetical protein
Activity 2.6.1.37
Family 2.6.1.37
Evidence ISS - similarity
Phylum Bacteria
OS Pseudomonas fluorescens
GB ZP_00083884.1
SQ
MSTAAPILLTPGPLTTSARTRQAMMVDWGSWDDRFNQLTASLCEQLLAILNGADSHHCVP
LQGSGTFAVEAAIGTLVPRDGKVLVLINGAYGKRLAKICEVLGRSFSTFETAEDEPTTAA
DVDRLLCADSDITHVALIHCETSTGILNPLPEIAQVVEQHGKRLIIDAMSSFGALPVDAQ
KVPFDALIAASGKCLEGVPGMGFVFARKESLAAAAGNSHSLAMDLFDQHSYMKKTGQWRF
TPPTHVVAALHEALLQYNEEGGLPARHARYAANCQALMEEMGKLGLRSFLPAAIQAPIIA
TFHAPKDPRYQFKDFYERVKAKGYILYPGKLTQVETFRVGCIGHVTPAQMREAVAAVSEV
LREMEVLDI
 
last changed 2005/03/16 20:04

B6db sequences