Activities | Families | Sequences | Fold types | References | Help
B6db sequences: zp.00088942

ZP_00088942

Description hypothetical protein [Azotobacter vinelandii]
Activity 2.6.1.18
Family 2.6.1.18
Evidence ISS - similarity
Phylum Bacteria
OS Azotobacter vinelandii
GB ZP_00088942
SQ
MNRSPETSSLVAGLNLRAHWMPFTANRDFQRDPRLVVAARGNYLTDAEGRQVYDSLSGLW
CCGAGHGRREIAEAVTRQLGTLDYSPGFQFGHPLSFRLAEKIASLTPAGLDHVFFTNSGS
ECADTALKIARAYWRLKGKAGKTRLIGRARGYHGVNLGGTAVGGIGGNRKAFGPLSDVDH
LPHTLLAENAFSRGLPAHGGAALADALLGLIELHDASNIAALIVEPMSGSAGVLVPPEGY
LARLREICDRHEILLIFDEVITGFGRTGALFGAERFGVTPDILNLAKQLTNGAAPMGAVL
VKGEIYDTFMRQELPEHAVEFAHGYTYSAHPVACAAALATLELLERDNLLQRAAELAPHF
ENALHGLRGARHLLDIRNCGLAGALQLAPRDGDALVRPFEAAMRLWRRGFYVRCGGDTLQ
FGPPFSSSAAELDRLFDAVGEVLGGLD
 
last changed 2010/01/08 13:10

B6db sequences